Senin, 26 Januari 2015

MENTARI @RP 65RB,PRASMANAN ALL U CAN EAT, PIN BB 29D9A9D0 (0=NOL), 081337766343, TEMPAT MAKAN DI BEDUGUL, RUMAH MAKAN DI BALI. TELPON MENTARI RESTORANKisah Inspiratif Nyata : Mahasiswa Asongan ~ Prestatif Dunia Akhirat



MENTARI @RP 65RB,PRASMANAN ALL U CAN EAT, PIN BB 29D9A9D0 (0=NOL), 081337766343, TEMPAT MAKAN DI BEDUGUL, RUMAH MAKAN DI BALI. TELPON MENTARI RESTORAN

Mentari Restaurant Bedugul @Rp 65.000/orang. Booking di 08563776704
Menu makan
Soup
Soto Ayam
Salad
Fresh garden salad/sayur
Main Course
Fish satay/sate lilitFried chickenayam gorengbreaded fillet fishIkan tepung Chinese ommeleteFuyung haiNasi putihNasi gorengMie gorengLumpia sau taucoKrupuk UdangFrench bread & butterGado-gado
Dessert
Caketropical fruitBanana Fritters with vanilla sauce Black porridge
Beverage
Tea and Coffee


SNORKELING
Snorkeling is a fantastic marine activity to over view the beautiful panorama of coral, colorful fishes and other unique marines life. This adventure will bring you the exciting experience with professional snorkeling guide who guide you the right snorkeling spot point. It will take about one hour to explore and view beautiful underwater life which is completed safety equipment. You can over view completely about the Snorkeling Activities throughout this site.


INFO HARGA WATERSPORT MURAH
TIKET WATERSPORT MURAH
Harga Satuan:
Glass bottom boat+ Turtle Island =Rp 350.000 per 1 boat utk 10 orang
Banana Boat = Rp 85.000.
Parasailing =Rp115.000
Ski donut = Rp 100.000
Rolling Donut = Rp 100.000

jet ski with instructor = Rp 155.000.
Flying Fish = Rp 155.000
Snorkeling = Rp 255.000
Water SKI =Rp 235.000
Sea walker = Rp 350.000
Scuba Diving 300.000 dapat 1 tangki oksigen untuk 1 jam. Sudah termasuk peralatannya.

Harga Paket:
• Parasailing+Banana Boat+ jet ski with instructor = Rp 350.000/orang.
• Glass bottom boat+ Turtle Island+ Snorkling =Rp 375.000/orang
• Parasailing+ Banana Boat+ Jetski with instructor+ scuba dive =Rp 500.000/orang
• Parasailing+Banana Boat+ Flying Fish+seawalker= Rp 655.000/orang.
Jika berminat kontak: 081337766343
Semua makan malam melalui pemesanan on line ini sudah termasuk tax dan service dan tidak ada tambahan apa-apa lagi. Anda membayar sesuai dengan harga yang tertera.

Info lainnya:
Rafting Telaga waja @Pp 235.000/ORANG
PAKET WISATA KE TRUNYAN @Rp 200.000/orang
PAKET MAKAN PRASMANAN Batur Indah di Kintamani@RP 35.000
MAU MAIN WATER SPORT DI TANJUNG BENOA? HANYA RP 20.000 SDH BS NAIK GLASSBOTTOM BOAT+PULAU PENYU. AMAN MERIAH UTK ANAK2

Paket Keluarga. Furama Sea Food restaurant
Jl Pantai Kedonganan, Jimbaran, Bali
Paket Spesial untuk 4 orang. Rp 485.000 untuk 4 orang
Reservasi: 08563776704-081 337766343- . BB 29D9A9D0(0=nol)

Menu: Welcome drink,
Balinese peanut,
Fish soup, Ikan 1 kg,
Udang 1 kg, Kerang 1 kg,
Calamary 1kg, Kepiting 1kg,
Nasi, Sayur kangkung,
Sambal, Buah
Soft Drink/Kelapa Muda
Khusus untuk paket ini kami bisa sajikan dengan bumbu-bumbu ala Chinese Food antara lain: Asam manis, saos padang, black paper sauce, sauce tiram, goreng mentega. Sesuai dgn permintaan.
Reservasi: 08563776704-081 337766343- . BB 29D9A9D0(0=nol)

=====================================================================================



RESTORAN KINTAMANI @RP 65RB,PRASMANAN , PIN BB 29D9A9D0 (0=NOL), 08563776704/081337766343, MAKAN DI RESTORAN KINTAMANI, GRAND PUNCAKSARI RESTORAN,

Restoran Kintamani. Makan siang di tepi gunung dengan view gunung dan danau. Grand Puncaksari, Kintamani.

Appetizer :
Mixed salad, Vegetables soup, Tomato soup, Bread
Main Courses :
Steamed rice, Fried rice, Fried noodles, Cap cay (Chinese mixed vegetables ), Gado gado (Steam vegetables with peanut sauce ) or fried vegetables., Fu yung hai, Fried onion, vegetables tempura, Fried fish with sweet and sour sauce, Fried chicken with sweet and sour soy sauce/chicken curry, Beef stroganoff, Fried potatoes, Spring roll, Chicken satay with peanut sauce, Shrimp crackers
Desserts :
Fried banana/jack fruit, Black rice pudding/black sticky rice, Sticky rice with pumpkins, Fruit salad, Fresh banana, Tropical fruits
Drinks ;
Hot coffee + milk, Hot Tea

SEWA MOBIL MURAH DI BALI: MOBIL+SOPIR+BBM = RP 450.000/12 JAM. 081337766343/ 08563776704 PIN BB 29D9A9D0 (0=NOL).BISA LANGSUNG JEMPUT DI BANDARA DAN ANTAR KE HOTEL.

Juga tersedia berbagai jenis mobil lain dengan self drive ( setir sendiri). Selengkapnya kunjungi: Klik Disini. Email: budd2id@yahoo.com.
Daftar harga sewa mobil+Sopir+BBM
Avanza/APV/Xenia = 450.000/10 Jam. 475.000/12 jam
ELF 12 seat = 850.000/12 jam
ELF 16 seat = 1000.000/12 jam
Pregio= 800/12 jam
Bus 28 seat = 1.5 jt /full day (sampai selesei makan malam)
Bus 40 seat= 2,4jt/full day (sampai selesei makan malam)

---------------------------
Paket Spesial untuk 4 orang. Rp 485.000/ bisa untuk 4 orang
Reservasi: 08563776704-081 337766343- . BB 29D9A9D0(0=nol)

Menu: Welcome drink, Balinese peanut, Fish soup, Ikan 1 kg, Udang 1 kg, Kerang 1 kg, Calamary 1kg, Kepiting 1kg, Nasi, Sayur kangkung, Sambal, Buah, Soft Drink/Kelapa Muda
Khusus untuk paket ini kami bisa sajikan dengan bumbu-bumbu ala Chinese Food antara lain: Asam manis, saos padang, black paper sauce, sauce tiram, goreng mentega. Sesuai dgn permintaan.

------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------------
Diskon Quicksilver Cruises. Dari harga 650.000/orang. Diskon 25.000 jadi Rp 625.000/orang.
TLP 081 337766343 - 08563776704 – 0361 7897939- PIN BB 29D9A9D0 (0=NOL),
Harga Quick Silver @Rp 625.000/orang termasuk:

• Antar jemput dari hotel ke pelabuhan (Hotel-Harbor-Hotel) utk Denpasar, Sanur, Kuta, Jimbaran & Nusa Dua area. Antar jemput di Ubud dikenakan biaya Rp 50.000/orang.
• Morning/Afternoon Coffee Tea & Snack,
• Permainannya meliputi: Snorkeling, Village Tour, Unlimited Banana Boat, Underwater Observatory, Waterslide, Ocean Water Treatment, Semi Submersible Vessel,
• Makan siang prasmanan: Tropical Buffet and Barbeque Lunch

Catatan:
• Antar jemput free/gratis tdk berlaku dari tgl 20 Juli sd 10 Agustus karena sedang musim ramai wisatawan asing.
• Jika minta antar jemput dikenakan tambahan Rp 40.000/orang utk periode tsb.
• Pembatalan 1 hari sebelum keberangkatan tanpa pemberitahuan secara tertulis dikenakan pemotongan 50%
• Pembayaran harus lunas 2 hari sebelum berangkat.

Bali Bird Park.
Tiket Bali Bird Park bisa dibeli di sini. Dewasa Harga Rp 90.000 diskon 10.000 jadi Rp 80.000 dan anak-anak Rp 40.000. Bisa keliling sambil menghibur anak-anak.
Reservasi: 081 337766343-08563776704-BB 29D9A9D0(0=nol).
budd2id's Bali Bird Park album on Photobucket
Cara pembelian voucher:
• Kirim sejumlah uang senilai jumlah tiket yang dibeli via BCA no 6110054651 atau Mandiri no 1450005505074 an Budi Susanto.
• Setelah transfer kirimkan: tgl kedatangan, nama, no HP, alamat email, dan no fax hotel tempat menginap selama di Bali.
• Voucher akan dikirim via email atau fax di hotel tempat menginap. Silakan diprint dan dibawa saat dating ke Bali Bird Park.
• Kantor Pemasaran: Jl Tukad Buaji XXVII Perum Ruchira Kavling 14, Denpasar.
• Tlp 0361-7897939 - 081 337766343-08563776704-BB 29D9A9D0(0=nol). Fax: 0361-245083
latestays Indonesia Bali Kintamani
Pesan Hotel Batur Lakeside Hut Resto Apung, harga promo murah sampai dengan 10 Jalan Raya Kedisan, Kedisan Village Kintamani BALI, Tunjukkan peta
Menikmati Panorama Alam Gunung & Danau Batur diranselwisata Dalam Negeri
Di Kintamani, ada beberapa restoran mewah yang memiliki konsep lake view yaitu menghadap ke danau karena letaknya di Foto karya Wisnu Taranninggrat
Wonderful Indonesia Kintamani Keindahan Memukau dan
indonesia.traveliddestination558kintamani
Kintamani dengan keindahan pemandangan Gunung Batur dan Danau Batur memadai sebagai tempat wisata, antara lain penginapan maupun restoran.
Batur Lakeside Hut Resto Apung in Kintamani, Bali
asiawebdirect Asia Indonesia Bali
Batur Lakeside Hut Resto Apung akan menjamin kepuasan menginap Anda di Kintamani semaksimal mungkin. Kami adalah pilihan tepat bagi Anda jika anda
Seminggu di Bali (6th Day) cendhikablog
cendhikablog201301seminggudibali6thday
29 Jan 2013 Perjalanan dari Hotel tempat kami menginap ke Kintamani menempuh teknik gambar bergerak (video) yang dibuat dari sequence fotogambar statis. untuk motret dari Restoran terapung yanterletak di pinggir danau.
rentalmobilbalikintamaniTerletak di Kecamatan Kintamani, Kabupaten Bangli. Gunung Batur pun sangat sangat menarik dijadikan lokasi pemotretan foto pre wedding. Banyak terdapat penginapan, restoran maupun warungwarung makanan dan minuman kecil
Mempunyai Tempat Foto Ke Arah Selatan Denpasar
tripadvisor.trLocationPhotoDirectLink
Restoran Suling Bali, Kintamani Resim Mempunyai Tempat Foto Ke Arah Selatan Denpasar TripAdvisor üyelerinin 1.092 gerçek Restoran Suling Bali
Paket Kintamani Layanan Pernikahan Wida Wedding
widawedding Layanan Paket Pernikahan Dengan Katering
3 Des 2014 Paket Kintamani Paket pernikahan komplit dari Wida Wedding dengan katering Paket kintamani terdiri dari Foto Pengantin 1 paket
Restoran Kintamani, Bali RESTORAN MENTARI BEDUGUL
restorankintamanibali.blogspotrestoranmentaribedugulrp81
7 Nov 2014 PAKET MAKAN PRASMANAN Batur Indah di KintamaniRP 35.000 RumahResto Mentari Bedugul, Foto Restoran di Bedugul ,Resto
Anda mengunjungi laman ini pada 141130.
Tempat Makan Asyik di Bali… Wisata Kompasiana
wisata.kompasiana09tempatmakanasyikdibali268045.ht
24 Sep 2010 info lebih lanjut bisa dilihat di info restoran di bali Resto Apung di Kintamani Apabila Tak Ada Foto Presiden di Gedung DPR RI …
Restoran di Kintamani View Gunung dan Danau Batur
tanjungbenoawatersportrestorandikintamaniviewgunungdan
16 Des 2010 Restoran di Kintamani View Gunung dan Danau Batur. Leave a reply Foto Pakaian Adat Bali, Rp. 520.000 300.000 orang. BOOK NOW >>
Kuliner Tourism's sitewisatakelilingbali.weeblykuliner
Resto ini menawarkan paket dari paket nasi timbel komplit, paket soto bandung ataupun paket nasi silahkan liat foto restoran grand puncak sari di kintamani
wisata kuliner nealyynealyycategorywisatakuliner
dengan menu buffet, termasuk juga makanan halal. silahkan liat foto restoran batur sari di kintamani. Restoran The Brandas, Garuda Wisnu Kencana Restoran
Jimbaran Cafe Rp 70rbperson. Restoran Seafood Bintang
Restoran Seafood Bintang Laut, Reservasi 08563776704 BB 29D9A9D0 (0nol) Menu makan di restoran kintamani, Grand puncaksari restoran, restoran
Anda telah mengunjungi laman ini berkalikali. Kunjungan terakhir 141201
Makan Siap Saji Picture of Restoran Suling Bali, Kintamani
tripadvisor.zaLocationPhotoDirectLinkg303952d4471891i731
Restoran Suling Bali, Kintamani Picture Makan Siap Saji Check out TripAdvisor Restoran Suling Bali Mempunyai Tempat Foto Ke Arah Selatan Denpasar.
Mempunyai Tempat Foto Ke Arah Selatan Denpasar
tripadvisor.grLocationPhotoDirectLin
Εικόνα του Restoran Suling Bali, Kintamani Mempunyai Tempat Foto Ke Arah Selatan Denpasar Δείτε 1.092 ρεαλιστικές εικόνες και βίντεο από μέλη του
Bersepeda Seru di Pedesaan Bali Travel Detik
travel.detikreadfoto20140410bersepedaserudipedesaanbali
10 Apr 2014 Ada kawasan perbukitan Kintamani juga Ubud, dan cara terbaik untuk menyusurinya adalah naik sepeda. Sebelum mulai gowes sepeda, tersedia sarapan di restoran Madu Asri, Kintamani. Total, tur ini Foto Lain.Restoran Kintamani
KINTAMANI AND PANDAWA BEACH (WITH PHOTOS)
muammarihsanway.blogspotjalanjalankintamanidanpandawa
25 Feb 2014 Lalu sehabis berfotofoto kami semua langsung balik arah dan menuju diucapkan pegawaipegawai restoran tersebut jika ada pengunjung.
Paket Tour Bali 2 Hari (Tanpa Hotel) Baliliburankubaliliburankup11924
8 Mei 2012 liburan di kintamani Batur yang mengesankan wajib untuk yang suka foto Makan siang di Kintamani Resto pemandangan yang indah plus
Restaurant Apung Satu satunya Wisata Kuliner Bali's
wisatakulinerbali201009restaurantapungsatusatun
17 Sep 2010 Namun kini, Kintamani juga dapat menjadi pilihan alternative untuk berwisata kuliner sejak dibukanya Restaurant Apung yang hingga saat ini
DAMPAK NEGATIF PARIWISATA DI DESA PENELOKAN
imaniartourism.blogspotdampaknegatifpariwisatadidesa
26 Jan 2010 Desa penelokan terletak di kecamatan Kintamani, kabupaten Bangli. Pembangunan restoran tanpa memikirkan nasib Kintamani di masa yang akan datang seolah menjadi sebuah ladang bisnis menjanjikan. Foto Saya.
Gunawan Restaurant di Jl Penelokan Kintamani,,Kintamani
Restaurant untuk Rumah Makan dan dapatkan informasi tentang produk terbaru, promo dan diskon inhouse dan promo kartu kreditrumah.trovitkintamanibangli
Foto House for sale in Kintamani Bangli IDR 55000 Depan danau persis, restoran, pool, buleleang, karaoke, 34 tahun hak pakai, anah adat, perpanjang
Makan Siang di Tepi Danau Batur My Life, My Story
liandamarta20131127makansiangditepidanaubatur
27 Nov 2013 Nah di hari pertama, sebenarnya kami ingin ke Kintamani, tapi Lanjut cerita di atas, jadi karena gak bisa fotofotoan melihat view Kintamani, kami pun di kintamani, stress saya jg makan di salah satu resto yg kebetulan di
Kintamani Restaurant, Kintamani TripAdvisor
tripadvisor.nl Restaurants in KintamaniSkor 2,5 ‎128 ulasan
Penelokan Grand Puncak Sari 2, Kintamani, Bali 80652, Indonesië. 62 366 51073. Deze vermelding verbeteren. Foto van Kintamani Restaurant. 54 foto's van
Promo Voucher Makan Seafood, Restaurant Terbagus di
telagawajapromovouchermakanseafoodrestaurantterbagusdi
17 Jan 2012 Promo Voucher Makan Seafood, Restaurant Terbagus di Kintamani dan dan banyak lagi promo, paket foto pakaian adat Bali, Busana Bali,
Tips Melancong Ke Bali Indonesia Bersama Keluarga
wazariwazirtipsmelancongkebaliindonesiabersamakel
30 Mar 2014 2014 Wazari Wazir Foto DiRakam di Sawah Padi Penestanan, Ubud nama restoran tu Sari Restaurant, Penelokan Kintamani, restoran
Honeymoon (Part 2 Maya Ubud, Monkey Forest, Batur
olinehai20130422honeymoonpart2
22 Apr 2013 Perjalanan dari Ubud ke Kintamani ditempuh 1 jam dengan kontur Kalau sudah kesini, jangan lupa makan siangnya di Restoran Batur Sari, disini all you can Kalau suka fotofoto jangan lewatin jalanan ini yah karenaThe Ayu Kintamani Villa Hoterip
hoterip Bali Kintamani
Harga Termurah dan Spesial Promosi untuk The Ayu Kintamani Villa in Kintamani Foto. The Ayu Kintamani Villa. Deluxe Pool Villa. The Ayu Kintamani Villa.
Kintamani, sisi 'dingin'nya Bali from nagari to anywhere
jalanjalanterus.me20080304kintamanisisidinginnyabali
4 Mar 2008 Sebelum ke Kintamani dari desa Ubud kita juga bisa menikmati Kintamani, dan di pinggir jalan tersebut juga terdapat cafecafe dan restoran yang >>>>yup…di foto diatas itu yang diatas danau itu sebeanranya sedang
Tempat Restaurant HALAL & Enak di Kintamani BaliPesan
bdwtourtempatrestauranthalalenakdikintamanibalipesa
27 Nov 2013 Voucher Waterbom Bali • Dolphin Lodge Lovina • Foto Pakaian Adat Bali Tempat Restaurant HALAL & Enak di Kintamani Batur Bali Pesan Voucher di Kintamani merupakan salah satu wisata terpavorit bagi wisatwan
Story Of My Life lebaran 2013, restoran apung di kintamani
aprietje.blogspot201308lebaran2013restoranapungdi
24 Agt 2013 lebaran 2013, restoran apung di kintamani bangli bali indonesia 12 Agustus 2013 pukul 046 penelokan menuju restoran apung kintamani bangli silahkan coba sensasi restoran apung bagi sobat yang belum Foto Saya.
u can eat MKutamkuta201305grandpuncaksari2restaurant
Makan Siang di Restoran Kintamani Foto team MKuta Holiday saat melayani client dari Team Pengawas Sun City Luxury Club Jakarta • Ikan bakar sambaln
Jalan2 Yuk Jalan2 ke Kintamani Batu Bulan, Celuk, Goa
octaviaarsanti.blogspot201208seharimenjelajahkintamani
18 Agt 2012 Yupacara hari ini kita khususkan ke Kintamani, dimana rute nya Batu bulanCelukDanau Untuk makan siang, jangan lewatkan restoran setempat yang ada di kintamani. semua foto di blog ini koleksi pribadi. ***bali paradise Oktober 2012
sapakawan.blogspot20121001archive
23 Okt 2012 restoran di kintamani dengan view danau dan gunung batur serta sisa aktifitas silahkan liat foto restoran grand puncak sari di kintamani
RESTORAN KINTAMANI RP 65RB,PRASMANAN ALL U
tour2bali.blogspotrestorankintamanirp65rbprasmananall46
30 Nov 2014 Hanya satu2nya restoran di Kintamani yang memiliki sertifikat halalo dari MUI. ALAMAT MENTARI BEDUGUL BALI, Ini Foto Keluargaku.
Kintamani Gunung dan Danau Batur Wisata Bali
wisatabali2010kintamanibatur
Kintamani, Pesona Gunung dan Danau Batur Di daerah pegunungan sekitar Di Penelokan (tempat melihatlihat), terdapat beberapa restoran, dimana Anda
BALI 2013 Day 2 Part II ~ Kintamani ~ Coffee Processing
farahwahyda.blogspotbali2013day2pa
16 Feb 2013 Perjalanan diteruskan pulak ke Kintamani yang terkenal dengan Batur Volcano. Sampai² jer mesti nak posing dulu suka sangat dengan restoran nie punya architectural.iran dia sangat cantekkkkharap² Foto Saya.
Hotel dan Rumah Makan Selamat Datang di Situs Resmi
banglikab.gocontentfasilitas&modeleftfasilitas
FOTO KEGIATAN 4, Restoran Kintamani, Penelokan, 450. 5, Restoran Pitaloka, Penelokan, 40. 6, Restoran Puncak Sari Lake View, Penelokan, 350.
Paket Tour Bali 4 Hari (Tanpa Hotel ) liburanbaliliburanbalip72
pemandangan dengan background kawah Gunung Batur yang mengesankan wajib untuk yang suka foto Makan siang di Kintamani resto buffet lunch Agro
Obyek Wisata Kintamani Pulau Bali Yang Indah Foto
fotowisataobyekwisatakintamanipulaubaliyangindah
2 Des 2013 Foto Wisata Pura Luhur Uluwatu di Bali Yang Eksotik Objek Wisata Goa di daerah kintamani banyak terdapat restoran yang menyediakan
The Ayu Kintamani di Kintamani Indonesia di Hotels
id.hotels Hotel Indonesia Hotel Kintamani
Lihat foto The Ayu Kintamani, ulasan tamu & peta. Periksa Flamboyant Resto restoran ini menyajikan sarapan, makan siang, dan makan malam. Tamu dapat
WISATA KULINER BALI balilomboktour
balilomboktourwisatakulinerbali
29 Nov 2012 Bila anda berwisata ke Kintamani jangan lupa untuk mampir ke Restaurant Apung yang berda di dekat danau Batur, tepatnya di desa kedisan,
Paket Liburan ke Jogyakarta RESTORAN KINTAMANI
tourbali3.blogspotrestorankintamanirp65rbprasmananall800
21 Apr 2014 Hanya satu2nya restoran di Kintamani yang memiliki sertifikat halalo dari Rp 185.000 sdh termasuk sewa pakaian dan rias plus dpt 3 foto
Anda telah mengunjungi laman ini 5 kali. Kunjungan terakhir 141031
Rizal Christian Trip Report, Nusa Lembongan, Padang Bai
rizalchristian.blogspottripreportnusalembonganpadangbai.ht
6 Agt 2014 Trip Report, Nusa Lembongan, Padang Bai, Ubud Kintamani, 26 Harga yang tercantum di foto diatas diberlakukan hanya untuk 'bule' saja.
Taman Bumi DestinAsian Indonesia
destinasianmendakitamanbumidibali
24 Mei 2013 Foto oleh Putu Sayoga Kamar mandi dan restoran tersedia. mujair, Flamboyant Resto & Bar (Jl. Puri Bening,Toya Bungkah, Kintamani
CATATAN RISKA SURYANI ADJI Membelah Kabut Kintamani
catatanriskasuryaniadji.blogspotmembelahkabutkintamani
23 Mar 2012 sayangnya dia memelukkuiyaaa maaakami bangun dan memutuskan untuk makan di resto apung danau kintamanihoreeee.
10 Daftar Tempat Makan Favorit Di Bali Scribd
sid.scribddoc10DaftarTempatMakanFavoritDiBali
19 Sep 2013 Restoran Batur Sari di Kintamani Sambil menikmati indahnya ke resto apung. termasuk juga makanan silahkan liat foto restoran grand
Blognya orang biasa Jalan & Jajan ke Kota Bogor (bagian
benysatyahadi.blogspotjalanjajankekotabogorbagianke2.ht
21 Nov 2010 Kalau resto di jalan utama adalah Resto Kintamani, Resto Ayam Goreng soalnya banyak fotonya, nanti akan bersambung lagi ke bagian 3.
The Ayu Kintamani, Kintamani Indonesia Expedia
expedia Hotel Asia Indonesia Bali Hotel
Skor 3,4 ‎15 ulasan
Pesan melalui Expedia dan simpan di The Ayu Kintamani in Kintamani, Indonesia. Foto Unggulan • Lobi • Kamar Tamu • Tempat Makan Di Kamar • Area Kamar Mandi • Kolam Renang Luar Ruangan • Restoran • Lahan Properti.
Wisata Kintamani Bali, Mengagumi Pesona Gunung dan
ensiklopediaindonesiawisatakintamanibalimengagumipesona
2 Agt 2013 Adapun kawasan wisata Kintamani yang berada di ketinggian 1500 meter diatas yang diperuntukkan bagi pengunjung berupa penginapan juga restoran.
(Arisca Meirinloveindonesia) (Foto balitoursclub
(Bulan Madu) Bali 3D2N3 Hari 2 Malam (Kintamani Tour)
melalibalipakethoneymoonbulanmadubali3d2n3hari
Hari ketiga Check Out Hotel, Foto Adat Bali, SPA, Antar Bandara. Hari Pertama Check Makan siang di Restoran Ayam Betutu Gilimanuk. Kemudian diantar
Kopi Kintamani, Bukti Kehebatan Petani JiaXiang
jiaxiangkopikintamanibuktikehebatanpetani
Desa Kintamani, Kabuparen Bangli, Provinsi Bali,
bagi wisatawan asing maupun domistik sudah Restoran Ayam Goreng Mulai Hidangkan Produk Organik.
Paket Tour Kintamani temanbali
temanbalipakettourkintamani
Kintamani Tour Dimulai dari penjemputan di hotel pukul 08.30 menuju ke pertunjukan tari Barong di Batubulan Kintamani makan siang di Kintamani resto
Love Life and Life will Love you back — Dari Kintamani ke
putliepost45098950334darikintamanikemuseumblanco
11 Mar 2013 Dari Kintamani ke Museum Blanco Setelah hampir 2 jam diatas motor, dan Berikut adalah fotofoto di museum antonio blanco, ubud. Restoran rondji tuh tempatnya adem dan nyaman banget, pelayan restaurannya juga
Restoran Halal dan Enak di Kintamani Bali Bounty Cruise
bountycruisebountycruisebalirestoranhalaldanenakdikinta
8 Agt 2011 Bounty Cruise Bali Restoran Halal dan Enak di Kintamani Bali. kintamani1 Mau menikmati hidangan makan siang dengan view gunung dan
Kintamani Bali Juga ada Hotel Bawah Tanah Terdalam ditipswisatamurah Bali
10 Feb 2013 Disekitar kintamani ditemukan rumah makan bumiayu. Tapi sayangnya foto bangunan bertuliskan rumah makan bumiayu yang dibawahnya
Peluang Investasi Menguntungkan. Dijual Kintamani
ponorogopropertipeluanginvestasimenguntungkandijualkintam
20 Mar 2013 DIJUAL Sebuah kawasan wahana air di ponorogo, Kintamani Waterpark, lokasi 1 buah restoran dengan kapasitas lebih dr 100 org, dengan nuansa desain pedesaan Fotofoto Acara di Kintamani Waterpark Ponorogo.Villa Kintamani Bali Mitula Properti
rumah.mitularumahvillakintamanibali
Depan danau persis,restoran,pool,buleleang,karaoke,34 tahun hak pakai,anah adat,perpanjang murah villa 20000 m2 bangli dijual. 2 foto. villa Mirip villa
Mempunyai Tempat Foto Ke Arah Selatan Denpasar
tripadvisor.nzLocationPhotoDirectLinkg303952i73122864K
Kintamani, Bali Picture Mempunyai Tempat Foto Ke Arah Selatan Denpasar Kintamani, Indonesia Overcharged on bill from lunch. Restoran Suling Bali.
Booking Mapa Lake View Bungalow , Kintamani
booking Indonesia Bali Hotel di Kintamani
Skor 7,610 ‎133 ulasankaki 10 menit dari Toya Bungkah hot springs, Mapa Lake View Bungalow terletak di pegunungan Kintamani yang indah. Restoran, Sarapan Dalam Kamar.
RESTO APUNG What a Beautiful Place dwitapratiwi
dwitapratiwi2012restoapungwhatabeautifulplace
7 Jan 2012 Pernah ada yg denger ga Resto Apung itu apaan hahahaha Jadi Resto Apung itu emang sebuah tempat wisata di daerah Kintamani, Bangli ngantukkkk mulu, nyaman bgt sihh (Sayang ga sempet foto bungalownya ') ).
restoran kintamani di Aceh 88DB
id.88dbindonesiaAcehqrestoran%20kintamani1
kintamani jantan umur 8 bln. pintar,sehat dan lincah. ( cocok buat jaga rumah lho ) Lokasi di Jakarta Mau Lihat Foto Anjing yg Besar Ingin menghubungi
Keindahan Penelokan Kintamani TeamTouring
teamtouringkeindahanpenelokankintamani
14 Jul 2012 Nama Penelokan Kintamani sepertinya sudah tidak asing lagi bagi wisatawan Atau bisa juga memarkir kendaraan di beberapa restoran atau cafe yang berada di dekat Penelokan Kintamani. (textfoto annosmile)Hotel di Kintamani Wego Indonesia
wego Hotel Murah Tujuan Asia Indonesia Bali
Cari harga hotel murah di Kintamani dari sekitar 45 hotel dan penginapan dekat Kintamani, Bali, Indonesia. Foto Alamat The Ayu kintamani Villa Kintamani.
Objek Wisata di Kintamani Bali Danau Gunung Batur
balitoursclubberita58Kintamani
Kintamani salah satu objek wisata di Bali, yang memiliki udara pegunungan Yang menjadi andalan bagi restoran disini selain makanan yang lezat dan halal
Paket Wisata ke Balipaket2wisata17 Nov 2014 Galeri foto Bromo Klik Di sini. Harga Paket Makan malam di Bintang laut Restoran, Jimbaran Check in Makan siang di Restoran Kintamani
Anda telah mengunjungi laman ini 2 kali. Kunjungan terakhir 141107
The Ayu Kintamani, Kintamani, Indonesia AirAsiaGo
airasiago Hotel Asia Indonesia Bali Hotel
Skor 3,4 ‎15 ulasanAnda membutuhkan pemesanan kamar di The Ayu Kintamani AirAsiaGo memiliki harga The Ayu Kintamani online terbaik Foto Unggulan Previous image.
K.B.A Tur Your Reliable Partner in Indonesiawisata.balikliktour2
Makan siang di Suling Bali restaurant di Kintamani. kerajaan Mengwi, Pura Ulun Danu dan Danau Beratan, Makan siang di Saranam Restoran. Selanjutnya diantar ke Denpasar untuk Foto pengantin dengan pakaian adat Bali, Seafood
One Stop Shopping Bali mj tour and travel
mjtourstravelwebpagebali
Makan siang di Kintamani restaurant sambil menikmati keindahan Danau dan Gunung Batur. Dilanjutkan dengan SPA selama 2 jam dan foto adat bali.
Rumah Makan Vegetarian Indonesia Supreme Master TV
suprememastertvinabbsboard.phpbotableveger
Catatan Beberapa restoran masih menggunakan Telur dan Susu. (sebelah Ricky Foto) Telp 021 6627472, f 6617535 Ruko Kintamani Blok C No.09
TIPS TRAVELLING, HOTEL & MAKAN MURAH DI BALI
terobosanhidupsehattipsjalanjalanmakanmurahdi
11 Okt 2012 Seninya travelling di Bali self managed Makanan Resto Murah Chinese (Kerajinan Perak) Makan siang di Kintamani Restaurant (view gunung dan MELIHAT PANDA di Cheng Du, ChinaIn "FOTO TEMPAT WISATA"
view from the loo صورة Restoran Suling Bali، Kintamani
tripadvisor.egLocationPhotoDirectLin
Restoran Suling Bali، ‪Kintamani‬ صورة view from the loo يمكنك الاطلاع على مقاطع Mempunyai Tempat Foto Ke Arah Selatan Denpasar • Makan Siap Saji.
Perjalanan Tak Berujung ku Ikuti Jejakmu Hingga Danau
cumilebay201301kuikutijejakmuhinggadanaubatur
Saat swa berada di Batur Natural Hot Spring sempet live report kirim foto via ke kintamani (omg itu 12 th yang lalu) hanya duduk2 di restoran sambil makanSweet Sunset in Bali Lie Fika
liefikamybeautyindonesiasweetsunsetinbali
Selama ini hanya melihat dari TV program atau fotofoto di wall calendar saja P siang Pak Gede menghantarkan kami ntuk makan ke Kintamani Resto yang
Lake View Hotel Kintamani Bali Indonesia Foto Galeri
asiarooms Asia Indonesia Bali
Lihatlah gambar dan foto Lake View Hotel Kintamani di Bali,Galeri Foto Lake View Hotel Kintamani di Bali. Restoran Tempat Makan • Lainnya • Lainnya.
Gagal melihat keindahan gunung dan danau Batur dari
liocooper201202gagalmelihatkeindahangunungdan
23 Feb 2012 Dalam program tour, rencananya kita akan ke kintamani, sebuah wilayah kalau seperti ini pasti foto akan dicetak dan dimintai untuk membelinya.
Paket Honeymoon (Bulan Madu) Bali 3D2N3 Hari 2 Malam
hargahotelpakethoneymoonbulanmadubali3d2n3har
Hari kedua Tampak Siring, Kintamani, Tegalalang, Monkey Forest, Tanah Lot. Hari ketiga Check Out Hotel, SPA, Foto Adat Bali, Antar Bandara. Makan siang di Restoran Galeri Mbok Limbok dan diantar menuju airport sesuai waktu
Nikmati Paket Promo Kintamani Tour KEBALILAGI
kebalilaginikmatipaketpromokintamanitour
Kintamani yang terkenal dengan keindahan danau baturnya akan kita jelajahi HARGA PROMO PAKET KINTAMANI TOUR KOLEKSI FOTO Bay, Seafood Resto Dengan Menu Yang Menggoda Selera • Berkunjung ke Desa Mas, PusatPaket Wisata
gamawisataindex.phpprodukdanlayanantourpaketwisata
Hari 02 Barong Kintamani Kebun Kopi Jimbaran (B, L, D) oleh2 Cening Ayu KintamaniMakan siang di Resto Panca Yoga (Kintamani)Perkebunan Kopi Bali JimbaranMakan malam di Anda juga akan mendapatkan fotofoto di sini.
Obyek Wisata Kintamani Danau Batur dan Gunung Batur
tempatwisataidobyekwisatakintamanidanaubaturdang
Fasilitas wisata Kintamani cukup memadai karena banyak penginapan, warung makan hingga restoran yang menawarkan makanan dan minuman dengan
JalanJalan ke Bali limaaprillimaapril20140504jalanjalankebali
4 Mei 2014 Foto pura ini pernah menjadi salah satu gambar di mata uang kita juga Siang itu kita makan di restoran D'Danau, restoran bertingkat 3 dengan Ketika sampai di pusat keramaian di area Kintamani, persis di dekan areaDesa Kintamani Bali Promosi
balipromosibalivillageindex.phpkintamanikintamani12bang
15 Agt 2014 Kintamani adalah sebuah kecamatan di Kabupaten Bangli, Provinsi Penelokan sudah mempunyai infrastruktur yang cukup memadai sebagai tempat wisata, antara lain penginapan maupun restoran. Beserta Foto Desa.Kintamani, Bangli Sahabat Jalan
sahabatjalan20110506kintamanibangli
6 Mei 2011 Kintamani, Bangli memadai sebagai tempat wisata, antara lain penginapan maupun restoran. Teks id.wikipedia.orgwikiKintamani,Bangli. Foto berliburdibali, ayobikincerita.blogspot
Anomali Coffee Restoran International di Setiabudi
abraresto Jakarta Selatan Setiabudi Setiabudi One
Skor 3,8 ‎7 suara ‎Kisaran harga 50k 100k IDR
2 Mar 2014 Sondi Ansori baru menambahkan foto di Anomali Coffee — via Comp Coba pesan kopi Bali Kintamani, jangan lupa pesan dengan French
Suling Bali Restoran, Kintamani Location Feed Instagrin
sinstagr.inl241113678
Suling Bali Restoran, Kintamani Location Feed. Instagrin is a web version of Instagram that allows anyone to browse through user, tag, and location feeds.
The Ayu Kintamani, Kintamani, Indonesia Traveloka
m.traveloka Hotel Indonesia Bali Bangli Kintamani
The Ayu Kintamani Booking online The Ayu Kintamani di Kintamani, jaminan Cicipi santapan lezat di restoran hotel dengan unggulannya, bar, atau tetap di kamar Sewaktu checkin diperlukan tanda pengenal dengan foto yang resmi
Mempunyai Tempat Foto Ke Arah Selatan Denpasar
tripadvisor.seLocationPhotoDirectLinkg30
Restoran Suling Bali, Kintamani Mempunyai Tempat Foto Ke Arah Selatan Denpasar Kolla in TripAdvisormedlemmarnas 1 074 bilder och videoklipp från
Pricilia Theodore on Twitter "Foto d kintamani ya Di
stwitterLhya47968267742097408
16 Mar 2011 Foto d kintamani ya Di restoran yg ada danaunya kan samzylgwyn plixip84378537 myloc.meizpKs. Wenang, Kota
Foto de Mount Batur, Kintamani disini tempat syuting ben
tripadvisor.mxLocationPhotoDirectLi
Imagen de Mount Batur, Kintamani disini tempat syuting ben joshua dan jessica Clasificado como N.º2 de 11 Atracciones en Kintamani restoran apung.
Ruangan Yang Luas Foto de Restoran Suling Bali
tripadvisor.brLocationPhotoDirectLin
Foto de Restoran Suling Bali, Kintamani Ruangan Yang Luas Confira as 1.067 fotos e vídeos reais dos membros do TripAdvisor de Restoran Suling Bali.
Restoran Suling Bali, Kintamani TripAdvisor
tripadvisor.brLocationPhotoDirectLin
Restoran Suling Bali, Kintamani Mempunyai Tempat Foto Ke Arah Selatan Denpasar Confira as 1.056 fotos e vídeos reais de membros do TripAdvisor de
Ada Ruang SholatPraying Room Foto de Restoran Suling
tripadvisor.brLocationPhotoDirectLin
Foto de Restoran Suling Bali, Kintamani Ada Ruang SholatPraying Room Confira as 1.064 fotos e vídeos reais dos membros do TripAdvisor de Restoran
Restoran Or Rumah Makan Search Govome
govomevideoqRestoran%20Or%20Rumah%20Makan
Rumah makan Kintamani. tlp 08563776704, 081337766343 Pin BB Jasa foto makanan, food photography, minuman, restoran, rumah makan, buku menu,…
Restoran Or Rumah Makan Govome
govomevideoqRestoran%20Or%20Rumah%20Makan
Jasa foto makanan, food photography, minuman, restoran, rumah makan, buku menu,… Rumah makan Kintamani. tlp 08563776704, 081337766343 Pin BB
RibangMedang [Bali] Gunung Batur, Kintamani Bali
travelerien201109baligunungbaturkintamanibali
17 Sep 2011 Ya sudah saya bisa punya waktu buat fotofoto meskipun hanya dari Terlihat cukup banyak restoran dan penginapan di Kintamani, mulai
Foto de Kintamani, Bali Mempunyai Tempat Foto Ke Arah
tripadvisor.peLocationPhotoDirectLin
Reportar como inapropiado. Mempunyai Tempat Foto Ke Arah Selatan Denpasar (Foto979, ago 2013). Restoran Suling Bali. Kintamani, Indonesia Makan Siap
Kintamani Resto & Cafe, Jl. Pajajaran No. 75, Bogor
eresep Restoran di Indonesia Restoran di
Kisah Inspiratif Nyata : Mahasiswa Asongan ~ Prestatif Dunia Akhirat

Tidak ada komentar:

Posting Komentar